PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009795221.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 436aa    MW: 46418.1 Da    PI: 9.9254
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009795221.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.83.1e-15358410557
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                     +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+  e+ ++ +
  XP_009795221.1 358 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQAEMMEMQK 410
                     79****************************************99888888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-13354418IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.53356407IPR004827Basic-leucine zipper domain
CDDcd147074.04E-29358410No hitNo description
PfamPF001704.4E-13358410IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-11358408No hitNo description
Gene3DG3DSA:1.20.5.1701.6E-14358408No hitNo description
PROSITE patternPS000360361376IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MGSNLNIKNY GNEPPGESGS GGAGVPLVRQ SSVYSLTFDE FLRGSGKDFG SMNMDELLKN  60
IWSAEESQNM GTSGVGGQEV GVPGGNLQRQ GSLTLPRTLS QKTVDEVWRD MSKEYCSGKD  120
GNGDVGLSNM PRRQQTLGEM TLEDFLVRAG VVREDAQLAA KASNVGVFGD MSHAGHSLGV  180
GFGYQQSNGN TAMVASRNID NNSGIGVQSG NLPLNVNGII SVQQQQGTMQ LQQQPQQQQQ  240
QQQQPLFPKQ PGLAYGAPMA IPTSGQLGSP GMRGGIVGIS DPALGSSLVQ TAALTGGGMN  300
MVGFGAGGVT GATGSPAVSS DGLGKSNGDT SSISPVPYVF SGGLRGRKGG AVEKVVERRQ  360
RRMIKNRESA ARSRARKQAY TMELEAEVAK LKEENEELRK KQAEMMEMQK NRVQEMMNLQ  420
RGAKRRCLRR TQTGPW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795221.10.0PREDICTED: bZIP transcription factor TRAB1-like
SwissprotQ9M7Q41e-128AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLV9XND30.0V9XND3_TOBAC; ABRE binding factor
STRINGPGSC0003DMT4000206700.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7762497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-108abscisic acid responsive elements-binding factor 2